PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598833.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 564aa    MW: 62638.6 Da    PI: 7.6841
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598833.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-3299155259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     dDgy+WrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++++ei+Y+g Hnh+
  XP_009598833.1  99 DDGYTWRKYGQKHVKGSEFPRSYYKCTQQNCPVKKKVERSP-DGQITEIVYKGAHNHH 155
                     8****************************************.***************8 PP

2WRKY103.11.6e-32311369159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+CtsagCpv+k+ver+ ++   v++tYeg+Hnhe
  XP_009598833.1 311 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSAGCPVRKHVERAPDNLISVITTYEGKHNHE 369
                     59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-2888156IPR003657WRKY domain
SuperFamilySSF1182906.8E-2595156IPR003657WRKY domain
SMARTSM007743.9E-3698156IPR003657WRKY domain
PROSITE profilePS5081122.81499157IPR003657WRKY domain
PfamPF031061.7E-2599155IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.0E-35296371IPR003657WRKY domain
SuperFamilySSF1182902.48E-28304371IPR003657WRKY domain
PROSITE profilePS5081136.472306371IPR003657WRKY domain
SMARTSM007745.5E-38311370IPR003657WRKY domain
PfamPF031061.1E-25312369IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MAPQSPTTGS FHFSTINQEN TMKTTQIARD HFEFPVESPK ATALKKCSLD IACETNVQQN  60
MSCIGLTNIH ESGNCARRAN QFEQRSAVTS NNITCNGSDD GYTWRKYGQK HVKGSEFPRS  120
YYKCTQQNCP VKKKVERSPD GQITEIVYKG AHNHHKSQPP RRATMSSTVY GLGETSEMSE  180
GNIGGSNSWR SVQFERNKDV RAPSGLDRTS SASVLTKVSD PLMLNYQKTN INAFESAGTT  240
PEPSSTLASR DDEDEDRATE GSTSLGDDVD DYAFDHKRRR REFYSVETSL SSRTTREPRV  300
VVQIESEIDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTSA GCPVRKHVER APDNLISVIT  360
TYEGKHNHEV PSANKTNCAI SGNQALTSTS KTHKVSNLGM QVQDCNFQFN RKPFDYVRPS  420
FLDLRFGATS PIYDLKFPTN LHSYGSFLLS PTQVSNSCSF APLQMPEFPL PLSLPMSLPL  480
VGPNIVPPLG GFHFNDLPLT PNGVSSHSSI AVGDQKYIHD DNNNNKNAII VRGNEEIKNE  540
NLCDHQNGAS SAVLCGQIMD NFPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-3299372878Probable WRKY transcription factor 4
2lex_A1e-3299372878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR5596780.0KR559678.1 Nicotiana benthamiana WRKY transcription factor (WRKY79) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598832.10.0PREDICTED: probable WRKY transcription factor 33 isoform X1
TrEMBLA0A0V0ITX20.0A0A0V0ITX2_SOLCH; Putative WRKY transcription factor 2-like
STRINGSolyc04g056360.2.11e-140(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.18e-78WRKY DNA-binding protein 2